PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna25098.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 224aa    MW: 25348.5 Da    PI: 8.236
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna25098.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.6e-171461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+WT  Ed ll+++++ +G g+Wk+++++ g+ R++k+c++rw +yl
  mrna25098.1-v1.0-hybrid 14 RGPWTRREDTLLIQYIQSHGEGHWKSVPKKAGLLRCGKSCRLRWINYL 61
                             89******************************99************97 PP

2Myb_DNA-binding50.54.8e-1667110146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg+ T++E++l+++++ +lG++ W++Ia +++ gRt++++k++w++
  mrna25098.1-v1.0-hybrid  67 RGNITPDEEDLIARLHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNT 110
                              7999******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.986961IPR017930Myb domain
SuperFamilySSF466892.75E-2912108IPR009057Homeodomain-like
SMARTSM007173.4E-131363IPR001005SANT/Myb domain
PfamPF002491.8E-151461IPR001005SANT/Myb domain
CDDcd001674.20E-111661No hitNo description
PROSITE profilePS5129423.90162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2465117IPR009057Homeodomain-like
SMARTSM007171.2E-1466114IPR001005SANT/Myb domain
PfamPF002491.3E-1467110IPR001005SANT/Myb domain
CDDcd001678.37E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MGRTPCCSKE GLQRGPWTRR EDTLLIQYIQ SHGEGHWKSV PKKAGLLRCG KSCRLRWINY  60
LRPDIKRGNI TPDEEDLIAR LHSLLGNRWS LIAGRLPGRT DNEIKNYWNT KLSKRLKNSG  120
STTKGASKPL NKDDQGSEAK VKVHQPKAFR VSANSMLAQL GHHDAEVSND LHDHNHFGDA  180
LVCENVKGFD DFDMYEEFQQ LLHKADQDYD GPDLDSFVDS LLI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004301814.11e-167PREDICTED: transcription repressor MYB5-like
SwissprotQ388506e-62MYB5_ARATH; Transcription repressor MYB5
TrEMBLB9GL113e-82B9GL11_POPTR; Uncharacterized protein
STRINGPOPTR_0001s11100.17e-82(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.14e-63myb domain protein 5